RBM38 Rabbit Polyclonal Antibody

CAT#: TA343854

Rabbit Polyclonal Anti-RBM38 Antibody

Product Images

WB Suggested Anti-RBM38 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM38 antibody: synthetic peptide directed towards the middle region of human RBM38. Synthetic peptide located within the following region: QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: RNA binding motif protein 38
• Database Link:
  NP_059965
  Entrez Gene 55544 Human
  UniProt ID Q9H0Z9
• Background: RBM38 is a probable RNA-binding protein.
• Synonyms: dJ800J21.2; HSRNASEB; RNPC1; SEB4B; SEB4D
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%