MBNL1 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 6
USD 325.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "MBNL1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MBNL1 antibody: synthetic peptide directed towards the C terminal of human MBNL1. Synthetic peptide located within the following region: LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | muscleblind like splicing regulator 1 |
Database Link | |
Background | MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA. |
Synonyms | EXP; EXP35; EXP40; EXP42; MBNL |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.