Germany
Japan
United Kingdom
China
SLC48A1 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of solute carrier family 48 (heme transporter), member 1 (SLC48A1)
USD 396.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "SLC48A1"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-FLJ20489 antibody: synthetic peptide directed towards the C terminal of human FLJ20489. Synthetic peptide located within the following region: LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 26 kDa |
| Gene Name | solute carrier family 48 member 1 |
| Database Link | |
| Background | The function remains unknown. |
| Synonyms | hHRG-1; HRG-1; HRG1 |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.