AKR1B10 Rabbit Polyclonal Antibody

CAT#: TA344167

Rabbit Polyclonal Anti-AKR1B10 Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10)
    • 20 ug

USD 823.00


Transient overexpression lysate of aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "AKR1B10"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-AKR1B10 antibody: synthetic peptide directed towards the N terminal of human AKR1B10. Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name aldo-keto reductase family 1, member B10 (aldose reductase)
Background AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Synonyms AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Rabbit: 100%; Zebrafish: 100%; Rat: 93%; Bovine: 93%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Butanoate metabolism, Fructose and mannose metabolism, Linoleic acid metabolism, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.