SOD2 Rabbit Polyclonal Antibody

CAT#: TA344296

Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region

Product Images

WB Suggested Anti-SOD2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Placenta

• 

  WB Suggested Anti-SOD2 antibody ; Titration: 0.4 ug/ml; Positive Control: Rat dorsal medulla brain & cortax + hypothalamus extract

• 

  Lanes: 1. 40ug rat dorsal medulla brain extract 2. 20 ug rat cortax + hypothalamus mitochondria extract; Primary Antibody Dilution: 1:2500; Secondary Antibody: Anti-Rabbit HRP; Secondary Antibody Dilution: 1:5000; Gene Name: SOD2; Submitted by: Manisha Na

• 

  Lanes: 1. 40 ug HK2 cell (kidney proximal tubular cell line) 2. 40 ug H2O2 treated human HK2 Cell lysate; 3. 40 ug H2O2 treated human HK2 Cell lysate; 4. 40 ug H2O2 treated human HK2 Cell lysate; 5. 40 ug H2O2 treated human HK2 Cell lysate; 6. 40 ug H2O2

• 

  5Hum. Fetal Brain; Host: Rabbit; Target Name: NOP56; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  6Hum. Fetal Muscle; Host: Rabbit; Target Name: NOP56; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

Show all 6 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: superoxide dismutase 2, mitochondrial
• Database Link:
  NP_000627
  Entrez Gene 24787 RatEntrez Gene 6648 Human
  UniProt ID P04179
• Background: SOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Synonyms: IPOB; MNSOD; MVCD6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Huntington's disease