SOD2 (NM_000636) Human Recombinant Protein
CAT#: TP302330
Recombinant protein of human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1
View other "SOD2" proteins (12)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 428.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202330 protein sequence
Red=Cloning site Green=Tags(s) MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQ EALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASV GVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINW ENVTERYMACKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000627 |
Locus ID | 6648 |
UniProt ID | P04179, A0A384NL29 |
Cytogenetics | 6q25.3 |
Refseq Size | 1593 |
Refseq ORF | 666 |
Synonyms | GClnc1; IPO-B; IPOB; Mn-SOD; MNSOD; MVCD6 |
Summary | This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. [provided by RefSeq, Apr 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Huntington's disease |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400235 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422510 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422511 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425454 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400235 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 396.00 |
|
LY422510 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 396.00 |
|
LY422511 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 396.00 |
|
LY425454 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 396.00 |
|
PH302330 | SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_000627) |
USD 2,055.00 |
|
PH312924 | SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001019636) |
USD 2,055.00 |
|
TP312924 | Recombinant protein of human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 823.00 |
|
TP720709 | Purified recombinant protein of Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review