SOD2 (NM_000636) Human Recombinant Protein
CAT#: TP720709
Purified recombinant protein of Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKKVDHHHHHH
|
Tag | N-His |
Predicted MW | 23.24 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mmTris,100mMNaCl,50%glycerol,pH8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000627 |
Locus ID | 6648 |
UniProt ID | P04179, A0A384NL29 |
Cytogenetics | 6q25.3 |
Refseq Size | 1593 |
Refseq ORF | 666 |
Synonyms | GClnc1; IPO-B; IPOB; Mn-SOD; MNSOD; MVCD6 |
Summary | 'This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. [provided by RefSeq, Apr 2016]' |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Huntington's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400235 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422510 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422511 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425454 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400235 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
LY422510 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
LY422511 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 325.00 |
|
LY425454 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 325.00 |
|
PH302330 | SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_000627) |
USD 2,055.00 |
|
PH312924 | SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001019636) |
USD 2,055.00 |
|
TP302330 | Recombinant protein of human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 823.00 |
|
TP312924 | Recombinant protein of human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review