SOD2 (NM_000636) Human Mass Spec Standard
CAT#: PH302330
SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_000627)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202330 |
| Predicted MW | 24.8 kDa |
| Protein Sequence |
>RC202330 protein sequence
Red=Cloning site Green=Tags(s) MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQ EALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASV GVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINW ENVTERYMACKK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000627 |
| RefSeq Size | 1593 |
| RefSeq ORF | 666 |
| Synonyms | GClnc1; IPO-B; IPOB; Mn-SOD; MNSOD; MVCD6 |
| Locus ID | 6648 |
| UniProt ID | P04179, A0A384NL29 |
| Cytogenetics | 6q25.3 |
| Summary | 'This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. [provided by RefSeq, Apr 2016]' |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Huntington's disease |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400235 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422510 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422511 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425454 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400235 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
| LY422510 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
| LY422511 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
| LY425454 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 396.00 |
|
| PH312924 | SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001019636) |
USD 2,055.00 |
|
| TP302330 | Recombinant protein of human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 823.00 |
|
| TP312924 | Recombinant protein of human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 823.00 |
|
| TP720709 | Purified recombinant protein of Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China