EEA1 Rabbit Polyclonal Antibody

CAT#: TA344445

Rabbit Polyclonal Anti-EEA1 Antibody - N-terminal region

Product Images

WB Suggested Anti-EEA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: ESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 162 kDa
• Gene Name: early endosome antigen 1
• Database Link:
  NP_003557
  Entrez Gene 216238 MouseEntrez Gene 314764 RatEntrez Gene 8411 Human
  UniProt ID Q15075
• Background: EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.
• Synonyms: MST105; MSTP105; ZFYVE2
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Bovine: 92%; Rabbit: 92%; Pig: 83%

Reference Data

• Protein Pathways: Endocytosis