Calcipressin 1 (RCAN1) Rabbit Polyclonal Antibody

CAT#: TA344568

Rabbit Polyclonal Anti-RCAN1 Antibody - N-terminal region

Product Images

WB Suggested Anti-RCAN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RCAN1 antibody: synthetic peptide directed towards the N terminal of human RCAN1. Synthetic peptide located within the following region: MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: regulator of calcineurin 1
• Database Link:
  NP_004405
  Entrez Gene 1827 Human
  UniProt ID P53805
• Background: RCAN1 interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease.
• Synonyms: ADAPT78; CSP1; DSC1; DSCR1; MCIP1; RCN1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 92%; Mouse: 77%

Reference Data

• Protein Families: Transcription Factors