PLAT Rabbit Polyclonal Antibody

CAT#: TA344649

Rabbit Polyclonal Anti-PLAT Antibody - middle region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Purified recombinant protein of Homo sapiens plasminogen activator, tissue (PLAT), transcript variant 3
    • 20 ug

USD 439.00


Transient overexpression lysate of plasminogen activator, tissue (PLAT), transcript variant 3
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "PLAT"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PLAT antibody: synthetic peptide directed towards the middle region of human PLAT. Synthetic peptide located within the following region: TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name plasminogen activator, tissue type
Background This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Synonyms T-PA; TPA
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 86%; Rabbit: 82%
Reference Data
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Complement and coagulation cascades

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.