TINAGL1 Rabbit Polyclonal Antibody

CAT#: TA344686

Rabbit Polyclonal Anti-TINAGL1 Antibody - middle region

Product Images

WB Suggested Anti-TINAGL1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TINAGL1 antibody: synthetic peptide directed towards the middle region of human TINAGL1. Synthetic peptide located within the following region: ENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: tubulointerstitial nephritis antigen like 1
• Database Link:
  NP_071447
  Entrez Gene 64129 Human
  UniProt ID Q9GZM7
• Background: TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.
• Synonyms: ARG1; LCN7; LIECG3; TINAGRP
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Rat: 92%; Horse: 86%; Mouse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein