KIAA1609 (TLDC1) Rabbit Polyclonal Antibody

CAT#: TA344746

Rabbit Polyclonal Anti-KIAA1609 Antibody

Product Images

WB Suggested Anti-KIAA1609 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIAA1609 antibody: synthetic peptide directed towards the N terminal of human KIAA1609. Synthetic peptide located within the following region: MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: TBC/LysM-associated domain containing 1
• Database Link:
  NP_065998
  Entrez Gene 57707 Human
  UniProt ID Q6P9B6
• Background: The function of KIAA1609 remains unknown.
• Synonyms: KIAA1609
• Note: Immunogen Sequence Homology: Human: 100%