SNTG1 Rabbit Polyclonal Antibody

CAT#: TA344834

Rabbit Polyclonal Anti-SNTG1 Antibody - N-terminal region

Product Images

WB Suggested Anti-Sntg1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Pancreas

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sntg1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: syntrophin gamma 1
• Database Link:
  NP_061840
  Entrez Gene 71096 Mouse
  UniProt ID Q9NSN8
• Background: Sntg1 is an adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. It may link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. It may participate in regulating the subcellular location of diacylglycerol kinase-zeta to ensure that diacylglycerol is rapidly inactivated following receptor activation.
• Synonyms: G1SYN; SYN4
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%