C9orf95 (NMRK1) Rabbit Polyclonal Antibody

CAT#: TA344957

Rabbit Polyclonal Anti-C9orf95 Antibody - N-terminal region

Product Images

WB Suggested Anti-C9orf95 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C9orf95 antibody: synthetic peptide directed towards the N terminal of human C9orf95. Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: nicotinamide riboside kinase 1
• Database Link:
  NP_060351
  Entrez Gene 54981 Human
  UniProt ID Q9NWW6
• Background: The function of C9orf95 remains unknown.
• Synonyms: bA235O14.2; C9orf95; NRK1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 79%; Mouse: 79%; Zebrafish: 75%

Reference Data

• Protein Pathways: Nicotinate and nicotinamide metabolism