C9orf95 (NMRK1) Rabbit Polyclonal Antibody

CAT#: TA344957

Rabbit Polyclonal Anti-C9orf95 Antibody - N-terminal region


USD 475.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1
    • 20 ug

USD 823.00


Transient overexpression lysate of chromosome 9 open reading frame 95 (C9orf95), transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "NMRK1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C9orf95 antibody: synthetic peptide directed towards the N terminal of human C9orf95. Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 23 kDa
Gene Name nicotinamide riboside kinase 1
Background The function of C9orf95 remains unknown.
Synonyms bA235O14.2; C9orf95; NRK1
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 79%; Mouse: 79%; Zebrafish: 75%
Reference Data
Protein Pathways Nicotinate and nicotinamide metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.