XAF1 Rabbit Polyclonal Antibody

CAT#: TA344995

Rabbit Polyclonal Anti-XAF1 Antibody - middle region

Product Images

WB Suggested Anti-XAF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-XAF1 antibody: synthetic peptide directed towards the middle region of human XAF1. Synthetic peptide located within the following region: RSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: XIAP associated factor 1
• Database Link:
  NP_059993
  Entrez Gene 54739 Human
  UniProt ID Q6GPH4
• Background: X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; M
• Synonyms: BIRC4BP; HSXIAPAF1; XIAPAF1
• Note: Immunogen Sequence Homology: Human: 100%