XAF1 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of XIAP associated factor 1 (XAF1), transcript variant 1
USD 396.00
Other products for "XAF1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-XAF1 antibody: synthetic peptide directed towards the middle region of human XAF1. Synthetic peptide located within the following region: SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 34 kDa |
Gene Name | XIAP associated factor 1 |
Database Link | |
Background | X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; M |
Synonyms | BIRC4BP; HSXIAPAF1; XIAPAF1 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.