MOK protein kinase (MOK) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of renal tumor antigen (RAGE)
USD 605.00
Other products for "MOK"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAGE antibody: synthetic peptide directed towards the middle region of human RAGE. Synthetic peptide located within the following region: TTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 48 kDa |
Gene Name | MOK protein kinase |
Database Link | |
Background | This gene belongs to the MAP kinase superfamily. The gene was found to be regulated by caudal type transcription factor 2 (Cdx2) protein. The encoded protein, which is localized to epithelial cells in the intestinal crypt, may play a role in growth arrest and differentiation of cells of upper crypt and lower villus regions. Multiple alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Dec 2012] |
Synonyms | RAGE; RAGE-1; RAGE1; STK30 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Goat: 79% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.