MOK protein kinase (MOK) Rabbit Polyclonal Antibody

CAT#: TA345115

Rabbit Polyclonal Anti-RAGE Antibody - middle region

Product Images

WB Suggested Anti-RAGE Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAGE antibody: synthetic peptide directed towards the middle region of human RAGE. Synthetic peptide located within the following region: TTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: MOK protein kinase
• Database Link:
  NP_055041
  Entrez Gene 5891 Human
  UniProt ID Q9UQ07
• Background: This gene belongs to the MAP kinase superfamily. The gene was found to be regulated by caudal type transcription factor 2 (Cdx2) protein. The encoded protein, which is localized to epithelial cells in the intestinal crypt, may play a role in growth arrest and differentiation of cells of upper crypt and lower villus regions. Multiple alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Dec 2012]
• Synonyms: RAGE; RAGE-1; RAGE1; STK30
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Goat: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase