PFKFB2 Rabbit Polyclonal Antibody

CAT#: TA345156

Rabbit Polyclonal Anti-PFKFB2 Antibody - C-terminal region

Product Images

WB Suggested Anti-Pfkfb2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pfkfb2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
• Database Link:
  NP_006203
  Entrez Gene 18640 Mouse
  UniProt ID O60825
• Background: Synthesis and degradation of fructose 2,6-bisphosphate.
• Synonyms: FBPase-2; PFK-2
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%; Yeast: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism