KLHL1 Rabbit Polyclonal Antibody

CAT#: TA345303

Rabbit Polyclonal Anti-KLHL1 Antibody

Product Images

WB Suggested Anti-KLHL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate; KLHL1 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Host: Rabbit; Target Name: KLHL1; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml; KLHL1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLHL1 antibody: synthetic peptide directed towards the middle region of human KLHL1. Synthetic peptide located within the following region: APLSMPRDAVGVCLLGDRLYAVGGYDGQTYLNTMESYDPQTNEWTQMASL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: kelch like family member 1
• Database Link:
  NP_065917
  Entrez Gene 57626 Human
  UniProt ID Q9NR64
• Background: KLHL1 contains 6 Kelch repeats and 1 BTB (POZ) domain..It is highly expressed in brain. KLHL1 may play a role in organizing the actin cytoskeleton of the brain cells.
• Synonyms: MRP2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 90%; Rat: 79%