KLF17 Rabbit Polyclonal Antibody

CAT#: TA345593

Rabbit Polyclonal Anti-KLF17 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of Kruppel-like factor 17 (KLF17)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "KLF17"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KLF17 antibody: synthetic peptide directed towards the N terminal of human KLF17. Synthetic peptide located within the following region: YGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 42 kDa
Gene Name Kruppel-like factor 17
Background KLF17 binds G/C-rich sites via its zinc fingers and activates transcription from CACCC-box elements. It may be a germ cell-specific transcription factor that plays important roles in spermatid differentiation and oocyte development.
Synonyms Zfp393; ZNF393
Note Immunogen Sequence Homology: Human: 100%; Rat: 82%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.