GRSF1 Rabbit Polyclonal Antibody

CAT#: TA345788

Rabbit Polyclonal Anti-GRSF1 Antibody

Product Images

WB Suggested Anti-GRSF1 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the N terminal of human GRSF1. Synthetic peptide located within the following region: SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: G-rich RNA sequence binding factor 1
• Database Link:
  NP_002083
  Entrez Gene 2926 Human
  UniProt ID Q12849
• Background: GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
• Synonyms: FLJ13125
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 85%; Bovine: 85%; Pig: 77%; Rat: 77%