GRSF1 Rabbit Polyclonal Antibody

CAT#: TA345789

Rabbit Polyclonal Anti-GRSF1 Antibody

Product Images

Host: Rabbit; Target Name: GRSF1; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: GRSF1; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: GRSF1; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml.GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: GRSF1; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: GRSF1; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: GRSF1; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: GRSF1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: GRSF1; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• WB Suggested Anti-GRSF1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate.GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

Show all 9 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the middle region of human GRSF1. Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: G-rich RNA sequence binding factor 1
• Database Link:
  NP_002083
  Entrez Gene 2926 Human
  UniProt ID Q12849
• Background: GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. The protein is localized in the cytoplasm, and has been shown to stimulate translation of viral mRNAs in vitro. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: FLJ13125
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%