ISG20 Rabbit Polyclonal Antibody

CAT#: TA345796

Rabbit Polyclonal Anti-ISG20 Antibody

Product Images

WB Suggested Anti-ISG20 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Daudi cell lysate; ISG20 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ISG20 antibody: synthetic peptide directed towards the N terminal of human ISG20. Synthetic peptide located within the following region: GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: interferon stimulated exonuclease gene 20kDa
• Database Link:
  NP_002192
  Entrez Gene 3669 Human
  UniProt ID Q96AZ6
• Background: ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
• Synonyms: CD25; HEM45
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 79%