CRM1 (XPO1) Rabbit Polyclonal Antibody

CAT#: TA345837

Rabbit Polyclonal Anti-XPO1 Antibody

Product Images

WB Suggested Anti-XPO1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

• 

  Host: Rabbit; Target Name: XPO1; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml; XPO1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Host: Rabbit; Target Name: XPO1; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml; XPO1 is supported by BioGPS gene expression data to be expressed in HeLa

• 

  Rabbit Anti-XPO1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in pinealocytes; Primary Antibody Concentration: 1: 100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1: 200; Magnification: 20X; Exposure Time: 0.5–2.0 sec;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-XPO1 antibody: synthetic peptide directed towards the C terminal of human XPO1. Synthetic peptide located within the following region: NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 123 kDa
• Gene Name: exportin 1
• Database Link:
  NP_003391
  Entrez Gene 7514 Human
  UniProt ID O14980
• Background: XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.The protein encoded by this gene mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CRM1; emb; exp1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Yeast: 85%

Reference Data

• Protein Families: Druggable Genome