CHERP Rabbit Polyclonal Antibody

CAT#: TA345959

Rabbit Polyclonal Anti-CHERP Antibody

Product Images

WB Suggested Anti-CHERP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysateCHERP is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHERP antibody: synthetic peptide directed towards the middle region of human CHERP. Synthetic peptide located within the following region: EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 104 kDa
• Gene Name: calcium homeostasis endoplasmic reticulum protein
• Database Link:
  NP_006378
  Entrez Gene 10523 Human
  UniProt ID Q8IWX8
• Background: CHERP is involved in calcium homeostasis, growth and proliferation.
• Synonyms: DAN16; SCAF6; SRA1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Pathways: Spliceosome