SF2 (SRSF1) Rabbit Polyclonal Antibody

CAT#: TA345989

Rabbit Polyclonal Anti-SFRS1 Antibody

Product Images

WB Suggested Anti-SFRS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that SRSF1 is expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the C terminal of human SFRS1. Synthetic peptide located within the following region: EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: serine/arginine-rich splicing factor 1
• Database Link:
  NP_008855
  Entrez Gene 6426 Human
  UniProt ID Q07955
• Background: SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene.Alternative mRNA splicing plays an important role in development and differentiation; many transcripts are spliced differently in distinct cell types and tissues. Both constitutive and alternative splicing occurs on spliceosomes, which are complex particles composed of small nuclear ribonucleoproteins (snRNPs) and non-snRNP proteins. The SR family of non-snRNP splicing factors is characterized by the presence of an RNA recognition motif and a serine- and arginine-rich (SR) domain. SR proteins are required at early stages of spliceosome assembly, have distinct but overlapping specificities for different pre-mRNAs, and can alter splice site choice, suggesting that they may be involved in the regulation of alternative splicing in vivo. Two of the SR proteins, ASF/SF2 (SFRS1) and SC35 (SFRS2; MIM 600813), have been extensively characterized.Alternative mRNA splicing plays an important role in development and differentiation; many transcripts are spliced differently in distinct cell types and tissues. Both constitutive and alternative splicing occurs on spliceosomes, which are complex particles composed of small nuclear ribonucleoproteins (snRNPs) and non-snRNP proteins. The SR family of non-snRNP splicing factors is characterized by the presence of an RNA recognition motif and a serine- and arginine-rich (SR) domain. SR proteins are required at early stages of spliceosome assembly, have distinct but overlapping specificities for different pre-mRNAs, and can alter splice site choice, suggesting that they may be involved in the regulation of alternative splicing in vivo. Two of the SR proteins, ASF/SF2 (SFRS1) and SC35 (SFRS2; MIM 600813), have been extensively characterized (Bermingham et al., 1995). [supplied by OMIM]
• Synonyms: ASF; SF2; SF2p33; SFRS1; SRp30a
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome