EFEMP1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
USD 823.00
Transient overexpression lysate of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
USD 396.00
Other products for "EFEMP1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 53 kDa |
Gene Name | EGF containing fibulin like extracellular matrix protein 1 |
Database Link | |
Background | EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.This gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy. |
Synonyms | DHRD; DRAD; EGF-containing fibulin-like extracellular matrix protein 1; FBLN3; FBNL; fibrillin-like; fibulin 3; FLJ35535; MGC111353; MLVT; MTLV; S1-5 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92% |
Reference Data | |
Protein Families | Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.