EFEMP1 Rabbit Polyclonal Antibody

CAT#: TA346014

Rabbit Polyclonal Anti-EFEMP1 Antibody

Product Images

WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: EGF containing fibulin like extracellular matrix protein 1
• Database Link:
  NP_004096
  Entrez Gene 2202 Human
  UniProt ID Q12805
• Background: EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.This gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.
• Synonyms: DHRD; DRAD; EGF-containing fibulin-like extracellular matrix protein 1; FBLN3; FBNL; fibrillin-like; fibulin 3; FLJ35535; MGC111353; MLVT; MTLV; S1-5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 92%; Guinea pig: 86%

Reference Data

• Protein Families: Secreted Protein