Uromucoid (UMOD) Rabbit Polyclonal Antibody

CAT#: TA346058

Rabbit Polyclonal Anti-UMOD Antibody

Product Images

WB Suggested Anti-UMOD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UMOD antibody: synthetic peptide directed towards the middle region of human UMOD. Synthetic peptide located within the following region: MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: uromodulin
• Database Link:
  NP_001008390
  Entrez Gene 7369 Human
  UniProt ID P07911
• Background: This gene encodes uromodulin, the most abundant protein in normal urine. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the lo
• Synonyms: ADMCKD2; FJHN; HNFJ; HNFJ1; MCKD2; THGP; THP
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 86%