BHMT Rabbit Polyclonal Antibody

CAT#: TA346077

Rabbit Polyclonal Anti-BHMT Antibody

Product Images

Lanes: Lane 1: 20 ug rat liver lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 15000; Gene Name: BHMT; Submitted by: Anonymous;

• 

  Lanes: Lane 1: 20 ug rat liver lysate; Primary Antibody Dilution: 1: 2000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 15000; Gene Name: BHMT; Submitted by: Anonymous;

• 

  WB Suggested Anti-BHMT Antibody; Titration: 2.5 ug/ml; Positive Control: Human Fetal Liver cell lysate

• 

  Host: Rabbit; Target Name: BHMT; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml

• 

  Rabbit Anti-BHMT Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: betaine--homocysteine S-methyltransferase
• Database Link:
  NP_001704
  Entrez Gene 81508 RatEntrez Gene 635 Human
  UniProt ID Q93088
• Background: BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.Betaine-homocysteine methyltransferase is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in BHMT could lead to hyperhomocyst(e)inemia,but such a defect has not yet been observed.
• Synonyms: BHMT1; HEL-S-61p
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Pathways: Cysteine and methionine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways