CEACAM6 Rabbit Polyclonal Antibody

CAT#: TA346090

Rabbit Polyclonal Anti-CEACAM6 Antibody

Product Images

WB Suggested Anti-CEACAM6 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: CEACAM6; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1.25 ug/mL; Peptide Concentration: 1.0 ug/mL; Lysate Quantity: 25 ug/lane; Gel Concentration: 12%

• 

  Rabbit Anti-CEACAM6 Antibody; Paraffin Embedded Tissue: Human Lung; Cellular Data: Alveolar cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CEACAM6 antibody: synthetic peptide directed towards the middle region of human CEACAM6. Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: carcinoembryonic antigen related cell adhesion molecule 6
• Database Link:
  NP_002474
  Entrez Gene 4680 Human
  UniProt ID P40199
• Background: Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.
• Synonyms: CD66c; CEAL; NCA
• Note: Immunogen Sequence Homology: Human: 100%