NAT8B Rabbit Polyclonal Antibody

CAT#: TA346134

Rabbit Polyclonal Anti-NAT8B Antibody

Product Images

WB Suggested Anti-NAT8B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NAT8B antibody: synthetic peptide directed towards the middle region of human NAT8B. Synthetic peptide located within the following region: SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: N-acetyltransferase 8B (putative, gene/pseudogene)
• Database Link:
  NP_057431
  Entrez Gene 51471 Human
  UniProt ID Q9UHF3
• Background: The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance.
• Synonyms: CML2; Hcml2; NAT8BP
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Yeast: 83%; Rat: 79%; Mouse: 79%; Rabbit: 79%