SLC17A3 Rabbit Polyclonal Antibody

CAT#: TA346434

Rabbit Polyclonal Anti-SLC17A3 Antibody

Product Images

WB Suggested Anti-SLC17A3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC17A3 antibody: synthetic peptide directed towards the middle region of human SLC17A3. Synthetic peptide located within the following region: FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: solute carrier family 17 member 3
• Database Link:
  NP_006623
  Entrez Gene 10786 Human
  UniProt ID O00476
• Background: SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.
• Synonyms: NPT4
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 85%

Reference Data

• Protein Families: Transmembrane