Grem1 Rabbit Polyclonal Antibody

CAT#: TA346473

Rabbit Polyclonal Anti-Grem1 Antibody

Product Images

Host: Rabbit; Target Name: Grem1; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Grem1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Grem1. Synthetic peptide located within the following region: EEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: gremlin 1, DAN family BMP antagonist
• Database Link:
  NP_035954
  Entrez Gene 23892 Mouse
  UniProt ID O70326
• Background: Grem1 is a cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as BMP a antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. It down-regulates the BMP4 signaling in a dose-dependent manner and acts as inhibitor of monocyte chemotaxis.
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 86%