Rabbit Polyclonal Anti-GREM1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Grem1 antibody is: synthetic peptide directed towards the middle region of Rat Grem1. Synthetic peptide located within the following region: PQPGSRTRGRGQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLK |
Rabbit Polyclonal Anti-Grem1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Grem1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Grem1. Synthetic peptide located within the following region: EEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL |
Rabbit Polyclonal Gremlin 1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing amino acids QPGSRNRGRGQGRGTA (52-67) of human CKTSF1B1 (NM_013372). |
Gremlin 1 (GREM1) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 95%) recombinant Human Gremlin-1 (Lys25-Asp184) derived from E. coli (Cat.-No AR26007PU-N). |
Gremlin 1 (GREM1) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 95%) recombinant Human Gremlin-1 (Lys25-Asp184) derived from E. coli (Cat.-No AR26007PU-N). |
Grem1 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Highly pure (>95%) recombinant Mouse Grem1 (Lys25-Asp184) derived from E. coli Cat.-No AR26008PU-N |
Grem1 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Highly pure (>95%) recombinant Mouse Grem1 (Lys25-Asp184) derived from E. coli Cat.-No AR26008PU-N |
Gremlin 1 (GREM1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 110-139 amino acids from the C-terminal region of Human Gremlin-1 / GREM1 |
Anti-GREM1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 25-184 amino acids of human gremlin 1 |
GREM1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 44-143 of human GREM1 (NP_001178252.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
