Zinc transporter 8 (SLC30A8) Rabbit Polyclonal Antibody

CAT#: TA346518

Rabbit Polyclonal Anti-SLC30A8 Antibody

Product Images

WB Suggested Anti-SLC30A8 Antibody Titration: 0.2-1 ug/ml; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC30A8 antibody: synthetic peptide directed towards the middle region of human SLC30A8. Synthetic peptide located within the following region: LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: solute carrier family 30 member 8
• Database Link:
  NP_776250
  Entrez Gene 169026 Human
  UniProt ID Q8IWU4
• Background: The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans. The encoded protein colocalizes with insulin in the secretory pathway granules of the insulin-secreting INS-1 cells. Allelic variants of this gene exist that confer susceptibility to diabetes mellitus, noninsulin-dependent (NIDDM). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
• Synonyms: ZnT-8; ZNT8
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 82%; Zebrafish: 75%

Reference Data

• Protein Families: Transmembrane