Calponin (CNN1) Rabbit Polyclonal Antibody

CAT#: TA346544

Rabbit Polyclonal Anti-CNN1 Antibody

Product Images

WB Suggested Anti-CNN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

• 

  Lanes: 1. 20 ug murine non-pregnant uteria tissue 2. 20 ug murine non-laboring uterine tissue 3. 20 ug murine laboring uterine tissue 4. 20 ug murine preterm laboring uterine tissue; Primary Antibody Dilution: 1: 2000; Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680; Secondary Antibody Dilution: 1: 25, 000; Gene Name: CNN1;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNN1 antibody: synthetic peptide directed towards the N terminal of human CNN1. Synthetic peptide located within the following region: MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: calponin 1
• Database Link:
  NP_001290
  Entrez Gene 12797 MouseEntrez Gene 1264 Human
  UniProt ID P51911
• Background: Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
• Synonyms: HEL-S-14; Sm-Calp; SMCC
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Pig: 93%; Zebrafish: 77%