Pyrophosphatase 1 (PPA1) Rabbit Polyclonal Antibody

CAT#: TA346635

Rabbit Polyclonal Anti-PPA1 Antibody

Product Images

WB Suggested Anti-PPA1 Antibody; Titration: 5.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPA1 antibody: synthetic peptide directed towards the N terminal of human PPA1. Synthetic peptide located within the following region: PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: pyrophosphatase (inorganic) 1
• Database Link:
  NP_066952
  Entrez Gene 5464 Human
  UniProt ID Q15181
• Background: The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. [provided by RefSeq, Jul 2008]
• Synonyms: HEL-S-66p; IOPPP; PP; PP1; SID6-8061
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 80%

Reference Data

• Protein Families: ES Cell Differentiation/IPS
• Protein Pathways: Oxidative phosphorylation