NEU2 Rabbit Polyclonal Antibody

CAT#: TA358676

NEU2 Antibody

Product Images

Rabbit Anti-NEU2 antibody Catalog Number: ARP64280 Formalin Fixed Paraffin Embedded Tissue: Human Adrenal Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

• 

  Rabbit Anti-NEU2 antibody Catalog Number: ARP64280 Formalin Fixed Paraffin Embedded Tissue: Human Placenta Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

Specifications

Product Data

• Applications: IHC
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH
• Specificity: Expected reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
  Homology: Cow: 79%; Dog: 86%; Guinea Pig: 85%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 77%; Rat: 79%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 42 kDa
• Gene Name: neuraminidase 2 (cytosolic sialidase)
• Database Link:
  NP_005374
  Entrez Gene 4759 Human
  UniProt ID Q9Y3R4
• Background: This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments.
• Synonyms: MGC129579; SIAL2

Reference Data

• Protein Pathways: Other glycan degradation, Sphingolipid metabolism