ADM2 Rabbit Polyclonal Antibody

CAT#: TA358772

ADM2 Antibody

Product Images

Rabbit Anti-ADM2 antibody Catalog Number: ARP64721 Formalin Fixed Paraffin Embedded Tissue: Human Pancreas Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

Specifications

Product Data

• Applications: IHC
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS
• Specificity: Expected reactivity: Cow, Horse, Human, Mouse, Pig, Rat
  Homology: Cow: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 83%; Rat: 93%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 16 kDa
• Gene Name: adrenomedullin 2
• Database Link:
  NP_001240774
  Entrez Gene 79924 Human
  UniProt ID Q7Z4H4
• Background: This gene encodes a protein which is a member of the calcitonin-related hormones. The encoded protein is involved in maintaining homeostasis in many tissues, acting via CRLR/RAMP receptor (calcitonin receptor-like receptor/receptor activity-modifying protein) complexes. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Synonyms: AM2; dJ579N16.4; FLJ21135; intermedin; OTTHUMP00000196596

Reference Data

• Protein Families: Druggable Genome, Secreted Protein