CENPA (NM_001042426) Human Tagged ORF Clone

CAT#: RC201602

CENPA (Myc-DDK-tagged)-Human centromere protein A (CENPA), transcript variant 2


  "NM_001042426" in other vectors (4)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "CENPA"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CENPA
Synonyms CenH3; CENP-A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201602 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCCGCGCCGCCGGAGCCGAAAGCCCGAGGCCCCGAGGAGGCGCAGCCCGAGCCCGACCCCGACCC
CCGGCCCCTCCCGGCGGGGCCCCTCCTTAGGCGCTTCCTCCCATCAACACAGTCGGCGGAGACAAGGTTG
GCTAAAGGAGATCCGAAAGCTTCAGAAGAGCACACACCTCTTGATAAGGAAGCTGCCCTTCAGCCGCCTG
GCAGCAGAAGCATTTCTAGTTCATCTCTTTGAGGACGCCTATCTCCTCACCTTACATGCAGGCCGAGTTA
CTCTCTTCCCAAAGGATGTGCAACTGGCCCGGAGGATCCGGGGCCTTGAGGAGGGACTCGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201602 protein sequence
Red=Cloning site Green=Tags(s)

MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL
AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001042426
ORF Size 342 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001042426.1, NP_001035891.1
RefSeq Size 1352 bp
RefSeq ORF 345 bp
Locus ID 1058
Cytogenetics 2p23.3
MW 13 kDa
Gene Summary 'Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.