CENPA (NM_001042426) Human Tagged ORF Clone

CAT#: RG201602

CENPA (GFP-tagged) - Human centromere protein A (CENPA), transcript variant 2

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: CENPA
• Synonyms: CenH3; CENP-A
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG201602 representing NM_001042426
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGCCCGCGCCGCCGGAGCCGAAAGCCCGAGGCCCCGAGGAGGCGCAGCCCGAGCCCGACCCCGACCC
  CCGGCCCCTCCCGGCGGGGCCCCTCCTTAGGCGCTTCCTCCCATCAACACAGTCGGCGGAGACAAGGTTG
  GCTAAAGGAGATCCGAAAGCTTCAGAAGAGCACACACCTCTTGATAAGGAAGCTGCCCTTCAGCCGCCTG
  GCAGCAGAAGCATTTCTAGTTCATCTCTTTGAGGACGCCTATCTCCTCACCTTACATGCAGGCCGAGTTA
  CTCTCTTCCCAAAGGATGTGCAACTGGCCCGGAGGATCCGGGGCCTTGAGGAGGGACTCGGC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG201602 representing NM_001042426
  Red=Cloning site Green=Tags(s)
  
  MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL
  AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001042426
• ORF Size: 342 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001042426.1, NP_001035891.1
• RefSeq Size: 1352 bp
• RefSeq ORF: 345 bp
• Locus ID: 1058
• Cytogenetics: 2p23.3
• Gene Summary: 'Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]'