ASCL4 (NM_203436) Human Tagged ORF Clone

CAT#: RC218928

ASCL4 (Myc-DDK-tagged)-Human achaete-scute complex homolog 4 (Drosophila) (ASCL4)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: ASCL4
• Synonyms: ASH-4; bHLHa44; HASH4
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC218928 representing NM_203436.
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGATGGAGACGCGTAAACCGGCGGAACGGCTGGCCTTGCCATACTCGCTGCGCACCGCGCCCCTGGGC
  GTTCCGGGGACCCTGCCCGGACTCCCGCGGAGGGACCCCCTCAGGGTCGCCCTGCGTCTGGACGCCGCG
  TGCTGGGAGTGGGCGCGCAGCGGCTGCGCACGGGGATGGCAGTACTTGCCCGTGCCGCTGGACAGCGCC
  TTCGAGCCCGCCTTCCTCCGCAAGCGCAACGAGCGCGAGCGGCAGCGGGTGCGCTGCGTGAACGAGGGC
  TATGCGCGCCTCCGAGACCACCTGCCCCGGGAGCTGGCAGACAAGCGCCTCAGCAAAGTGGAGACGCTC
  CGCGCTGCCATCGACTACATCAAGCACCTGCAGGAGCTGCTGGAGCGCCAGGCCTGGGGGCTCGAGGGC
  GCGGCCGGCGCCGTCCCCCAGCGCAGGGCGGAATGCAACAGCGACGGGGAGTCCAAGGCCTCTTCGGCG
  CCTTCGCCCAGCAGCGAGCCCGAGGAGGGGGGCAGC
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
  ATCCTGGATTACAAGGATGACGACGATAAGGTTTAA
  
  Protein Sequence

  >Peptide sequence encoded by RC218928
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MMETRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSA
  FEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEG
  AAGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_203436
• ORF Size: 519 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_203436.2, NP_982260.2
• RefSeq Size: 2260 bp
• RefSeq ORF: 519 bp
• Locus ID: 121549
• UniProt ID: Q6XD76
• Cytogenetics: 12q23.3
• MW: 19.4 kDa
• Gene Summary: Basic helix-loop-helix transcription factors, such as ASCL4, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008]