DYNLRB1 (NM_014183) Human Mass Spec Standard

CAT#: PH300051

DYNLRB1 MS Standard C13 and N15-labeled recombinant protein (NP_054902)

Product Images

Coomassie blue staining of purified DYNLRB1 protein (Cat# TP300051). The protein was produced from HEK293T cells transfected with DYNLRB1 cDNA clone (Cat# RC200051) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200051
• Predicted MW: 10.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200051 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLR
  IRSKKNEIMVAPDKDYFLIVIQNPTE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054902
• RefSeq Size: 717
• RefSeq ORF: 288
• Synonyms: BITH; BLP; DNCL2A; DNLC2A; ROBLD1
• Locus ID: 83658
• UniProt ID: Q9NP97
• Cytogenetics: 20q11.22
• Summary: This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18. [provided by RefSeq, Aug 2013]