DYNLRB1 (NM_014183) Human Recombinant Protein

CAT#: TP300051

Recombinant protein of human dynein, light chain, roadblock-type 1 (DYNLRB1)

Product Images

Coomassie blue staining of purified DYNLRB1 protein (Cat# TP300051). The protein was produced from HEK293T cells transfected with DYNLRB1 cDNA clone (Cat# RC200051) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200051 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLR
  IRSKKNEIMVAPDKDYFLIVIQNPTE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_054902
• Locus ID: 83658
• UniProt ID: Q9NP97
• Cytogenetics: 20q11.22
• Refseq Size: 717
• Refseq ORF: 288
• Synonyms: BITH; BLP; DNCL2A; DNLC2A; ROBLD1
• Summary: This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18. [provided by RefSeq, Aug 2013]