C9orf95 (NMRK1) (NM_017881) Human Mass Spec Standard

CAT#: PH300160

C9orf95 MS Standard C13 and N15-labeled recombinant protein (NP_060351)

Product Images

Coomassie blue staining of purified NMRK1 protein (Cat# TP300160). The protein was produced from HEK293T cells transfected with NMRK1 cDNA clone (Cat# RC200160) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200160
• Predicted MW: 23.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200160 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAI
  SCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSP
  GYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060351
• RefSeq Size: 1207
• RefSeq ORF: 597
• Synonyms: bA235O14.2; C9orf95; NRK1
• Locus ID: 54981
• UniProt ID: Q9NWW6
• Cytogenetics: 9q21.13
• Summary: Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]). [supplied by OMIM, Mar 2008]
• Protein Pathways: Nicotinate and nicotinamide metabolism