CRABP2 (NM_001878) Human Mass Spec Standard

CAT#: PH300221

CRABP2 MS Standard C13 and N15-labeled recombinant protein (NP_001869)

Product Images

Coomassie blue staining of purified CRABP2 protein (Cat# TP300221). The protein was produced from HEK293T cells transfected with CRABP2 cDNA clone (Cat# RC200221) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200221
• Predicted MW: 15.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200221 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGE
  EFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001869
• RefSeq Size: 1088
• RefSeq ORF: 414
• Synonyms: CRABP-II; RBP6
• Locus ID: 1382
• UniProt ID: P29373
• Cytogenetics: 1q23.1
• Summary: 'This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010]'
• Protein Families: Druggable Genome, Transcription Factors