CRABP2 (NM_001878) Human Recombinant Protein
CAT#: TP300221
Recombinant protein of human cellular retinoic acid binding protein 2 (CRABP2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200221 protein sequence
Red=Cloning site Green=Tags(s) MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGE EFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001869 |
Locus ID | 1382 |
UniProt ID | P29373 |
Cytogenetics | 1q23.1 |
Refseq Size | 1088 |
Refseq ORF | 414 |
Synonyms | CRABP-II; RBP6 |
Summary | This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419677 | CRABP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419677 | Transient overexpression lysate of cellular retinoic acid binding protein 2 (CRABP2) |
USD 325.00 |
|
PH300221 | CRABP2 MS Standard C13 and N15-labeled recombinant protein (NP_001869) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review