Growth Arrest Specific Protein 7 (GAS7) (NM_201432) Human Mass Spec Standard

CAT#: PH300285

GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_958836)

Product Images

Coomassie blue staining of purified GAS7 protein (Cat# TP300285). The protein was produced from HEK293T cells transfected with GAS7 cDNA clone (Cat# RC200285) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200285
• Predicted MW: 47.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200285 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKPGMVPPPPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGSHRSSLPPTVN
  GYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSY
  CDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGS
  LGEAWAQVKKSLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKAR
  KALTERQRDLEMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELER
  LEVERVEMIRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_958836
• RefSeq Size: 8181
• RefSeq ORF: 1248
• Synonyms: MLL/GAS7
• Locus ID: 8522
• UniProt ID: O60861
• Cytogenetics: 17p13.1
• Summary: Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors