Growth Arrest Specific Protein 7 (GAS7) (NM_201432) Human Mass Spec Standard
CAT#: PH300285
GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_958836)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200285 |
| Predicted MW | 47.7 kDa |
| Protein Sequence |
>RC200285 protein sequence
Red=Cloning site Green=Tags(s) MKPGMVPPPPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGSHRSSLPPTVN GYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSY CDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGS LGEAWAQVKKSLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKAR KALTERQRDLEMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELER LEVERVEMIRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_958836 |
| RefSeq Size | 8181 |
| RefSeq ORF | 1248 |
| Synonyms | MLL/GAS7 |
| Locus ID | 8522 |
| UniProt ID | O60861 |
| Cytogenetics | 17p13.1 |
| Summary | Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404414 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC404415 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC418527 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY404414 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant b |
USD 436.00 |
|
| LY404415 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant c |
USD 665.00 |
|
| LY418527 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant a |
USD 436.00 |
|
| PH315256 | GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_003635) |
USD 2,055.00 |
|
| TP300285 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant b |
USD 867.00 |
|
| TP315256 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant a |
USD 748.00 |
|
| TP720200 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant d |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China